General Information

  • ID:  hor005707
  • Uniprot ID:  P19209
  • Protein name:  Somatostatin 14
  • Gene name:  sst
  • Organism:  Myxine glutinosa (Atlantic hagfish)
  • Family:  Somatostatin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Myxine (genus), Myxininae (subfamily), Myxinidae (family), Myxiniformes (order), Myxini (class), Cyclostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AGCKNFFWKTFTSC
  • Length:  14(21-34)
  • Propeptide:  AVERPRQDGQVHEPPGRERKAGCKNFFWKTFTSC
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Somatostatin inhibits the release of somatotropin.
  • Mechanism:  NA
  • Cross BBB:  YES
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  86 seconds ( PubMed ID: 6117506 )

Structure

  • Disulfide bond:  45730
  • Structure ID:  AF-P19209-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005707_AF2.pdbhor005707_ESM.pdb

Physical Information

Mass: 187196 Formula: C76H106N18O19S2
Absent amino acids: DEHILMPQRVY Common amino acids: F
pI: 8.82 Basic residues: 2
Polar residues: 7 Hydrophobic residues: 5
Hydrophobicity: 2.86 Boman Index: -970
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 7.14
Instability Index: 3065 Extinction Coefficient cystines: 5625
Absorbance 280nm: 432.69

Literature

  • PubMed ID:  2896118##6117506
  • Title:  Primary structures of somatostatins from the islet organ of the hagfish suggest an anomalous pathway of posttranslational processing of prosomatostatin-1.